PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0040s0480.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 800aa    MW: 89725.4 Da    PI: 4.9512
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0040s0480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS378.39.2e-1164227961373
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL+ cA+a+s++d ++a++lL+++++++sp gd +qRla++f+++L+arl++s+++  + +++ ++++++ ++ l+a+k+  ++
  SapurV1A.0040s0480.1.p 422 LRTLLILCAQAISTDDSRNANELLKQIRQHSSPLGDGTQRLAHFFANGLEARLFGSGNGAPNYFSSLTSKRTTAADMLKAYKTQLQA 508
                             5789******************************************************************9**************** PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+ k+s   a ++Il a+e+++++Hi+Df++ +G+QWp+L+q+L+  p+gpp+lR+Tg++ p++g   +e++eetg+rLa+++e++
  SapurV1A.0040s0480.1.p 509 CPFKKLSIAFAIKMILHAAEKATTLHIVDFGVLYGFQWPSLIQQLSLLPNGPPKLRLTGIELPQHGfrPSERIEETGRRLANYCERF 595
                             *****************************************************************9********************* PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             +vpfe+n+++a+++e++ +e+L+++++E+laVn+ ++ ++llde+v+++ ++d+vLkl+++++P+++v++  + ++n++ Fl+rf e
  SapurV1A.0040s0480.1.p 596 KVPFEYNPITAQNWEKIPIEDLKINRNEVLAVNCLFRFKNLLDETVEVDCPKDAVLKLIRKMNPDIFVHAIVNGSYNAPFFLTRFRE 682
                             *************************************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             al ++s+lfd l+++lpre++er++ Ere++g++++nv+aceg+ r+er et+++W+ r  +aGFkp+p++++ +++ k  l+ ++ 
  SapurV1A.0040s0480.1.p 683 ALFHFSSLFDILDSTLPREDQERMMFEREFFGQDAMNVIACEGQGRVERPETYKQWQVRTLRAGFKPLPFDQELMTKFKGKLKSCYH 769
                             **************************************************************************************8 PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaW 373
                             + + ++e+++++++gWk+r +++ S+W
  SapurV1A.0040s0480.1.p 770 KDFVIDEDNNWMLQGWKGRIIFASSCW 796
                             89************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.146396777IPR005202Transcription factor GRAS
PfamPF035143.2E-113422796IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MVMDRNYTGL FDYQNDSKFD ETIVFPISDQ YPETELGLEF NTPSPDLSFI NLPFDPHDSD  60
PDSFRLSFNL NPAGVSSVPS MSLSPDGSGS LDPLTGLNPE AEASSSSEDS DFTDPLLKYI  120
SQMLMEENMK DQPHMFHDHF ALSATEKSLY DALGEQYPPS PNSSQSCPRH DSPNSNISAT  180
GSYCGDNTSN STSTCNCSAT TDFSKDSQRV SGDADVGGSN PSFLRTSLLG DNHFQSNLRP  240
NIQFSANPSN GITNTRDSLM GPSAGEMAQD MFSDMESVLQ FKRGLEEASK FLPSASQLVI  300
DLETNTFSTW KKEETPRVVV KEEKSERDSS PNGSRGRKNH EREDWDLEEG RSNKQSAVHV  360
EEGELSEMFD KVLLWTGGQC CGNDADQEVG CKSLQPDEQS NGSSGGKSRS KRQNKRMETV  420
DLRTLLILCA QAISTDDSRN ANELLKQIRQ HSSPLGDGTQ RLAHFFANGL EARLFGSGNG  480
APNYFSSLTS KRTTAADMLK AYKTQLQACP FKKLSIAFAI KMILHAAEKA TTLHIVDFGV  540
LYGFQWPSLI QQLSLLPNGP PKLRLTGIEL PQHGFRPSER IEETGRRLAN YCERFKVPFE  600
YNPITAQNWE KIPIEDLKIN RNEVLAVNCL FRFKNLLDET VEVDCPKDAV LKLIRKMNPD  660
IFVHAIVNGS YNAPFFLTRF REALFHFSSL FDILDSTLPR EDQERMMFER EFFGQDAMNV  720
IACEGQGRVE RPETYKQWQV RTLRAGFKPL PFDQELMTKF KGKLKSCYHK DFVIDEDNNW  780
MLQGWKGRII FASSCWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-464267968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042723.10.0PREDICTED: scarecrow-like protein 34
RefseqXP_011042722.10.0PREDICTED: scarecrow-like protein 34
RefseqXP_011042721.10.0PREDICTED: scarecrow-like protein 34
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9HPF70.0B9HPF7_POPTR; Uncharacterized protein
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14